Protein Info for ABZR86_RS07055 in Dyella japonica UNC79MFTsu3.2

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 198 to 214 (17 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details amino acids 255 to 277 (23 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 319 to 341 (23 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 5 to 337 (333 residues), 93.6 bits, see alignment E=6.2e-31

Best Hits

KEGG orthology group: None (inferred from 61% identity to xal:XALc_0367)

Predicted SEED Role

"O-antigen acetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2G0Z7 at UniProt or InterPro

Protein Sequence (369 amino acids)

>ABZR86_RS07055 acyltransferase (Dyella japonica UNC79MFTsu3.2)
MHRLPGLDLLRAIAIVWVMLFHSYFVGGLGDGWSWLEDNGWAGVDLFFVLSGYLIGSQWL
KPLAEGRPPAFGRFYLRRALRTMPAFLAVLAVYFALPSAREAPGIQPLWQFLTYTVNFLI
DYEHNKAFSHVWSLCVEEHFYLLFPLLAWWVARRGSLRAFVALCLFLLLGGMALRWWLFV
HMGERPFVEVIYYPTWNRLDGLLAGVVLAATQAYRPALWARLQAKANLALLAGVVLTGIA
LAIFQDRAGLLASVLGYPLLSWGLALIVAAATSPACWLGRHRVPGAGWLALVSYSLYLDH
KLVFHAVQTWLAAHPAIQGLAAFALYAICALAGGALLHYAVERPFLRLRDRLQAGRATRP
ALAPTSAGA