Protein Info for ABZR86_RS07040 in Dyella japonica UNC79MFTsu3.2

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 22 to 182 (161 residues), 115.8 bits, see alignment E=7.5e-38 PF04542: Sigma70_r2" amino acids 26 to 92 (67 residues), 60 bits, see alignment E=3.1e-20 PF07638: Sigma70_ECF" amino acids 64 to 182 (119 residues), 27.4 bits, see alignment E=6.1e-10 PF08281: Sigma70_r4_2" amino acids 125 to 178 (54 residues), 50.8 bits, see alignment E=2.2e-17 PF04545: Sigma70_r4" amino acids 131 to 180 (50 residues), 53.9 bits, see alignment E=2e-18

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 63% identity to bpt:Bpet3159)

Predicted SEED Role

"putative Ecf-type RNA polymerase sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2FZU9 at UniProt or InterPro

Protein Sequence (184 amino acids)

>ABZR86_RS07040 RNA polymerase sigma factor (Dyella japonica UNC79MFTsu3.2)
MDTAVDEDATLMLAYAQGDLGAFEALYARHRGTLYRFLLRACRQPAVADELFQETWSRVI
AARERYQPQAKFTTWLLQIAHNLLVDSYRRKRPTLDGEAGELAIAQMEAPAQEQPEHALS
DFEQRRRLQRAIEQLPDEQRTAVLLRLEQELSLEEIADVTGVGRETVKSRLRYAMNKLRE
QLAE