Protein Info for ABZR86_RS07020 in Dyella japonica UNC79MFTsu3.2
Annotation: NAD(P)-dependent alcohol dehydrogenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 55% identical to ADHC_MYCTU: NADP-dependent alcohol dehydrogenase C (adhC) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
KEGG orthology group: K13979, uncharacterized zinc-type alcohol dehydrogenase-like protein [EC: 1.-.-.-] (inferred from 77% identity to pap:PSPA7_2965)MetaCyc: 56% identical to S-(hydroxymethyl)bacillithiol dehydrogenase (Bacillus subtilis subtilis 168)
RXN-18814 [EC: 1.1.1.306]
Predicted SEED Role
"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)
MetaCyc Pathways
- superpathway of anaerobic sucrose degradation (17/19 steps found)
- heterolactic fermentation (14/18 steps found)
- 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
- ethanol degradation II (3/3 steps found)
- pyruvate fermentation to ethanol II (2/2 steps found)
- pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
- acetaldehyde biosynthesis I (1/1 steps found)
- phytol degradation (3/4 steps found)
- L-isoleucine degradation II (2/3 steps found)
- L-leucine degradation III (2/3 steps found)
- L-methionine degradation III (2/3 steps found)
- L-valine degradation II (2/3 steps found)
- formaldehyde oxidation V (bacillithiol-dependent) (2/3 steps found)
- ethanol degradation I (1/2 steps found)
- mixed acid fermentation (11/16 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (13/19 steps found)
- superpathway of N-acetylneuraminate degradation (15/22 steps found)
- L-phenylalanine degradation III (2/4 steps found)
- L-tyrosine degradation III (2/4 steps found)
- salidroside biosynthesis (2/4 steps found)
- serotonin degradation (4/7 steps found)
- pyruvate fermentation to ethanol I (1/3 steps found)
- pyruvate fermentation to ethanol III (1/3 steps found)
- noradrenaline and adrenaline degradation (8/13 steps found)
- superpathway of fermentation (Chlamydomonas reinhardtii) (5/9 steps found)
- (S)-propane-1,2-diol degradation (2/5 steps found)
- acetylene degradation (anaerobic) (2/5 steps found)
- ethanolamine utilization (2/5 steps found)
- phenylethanol biosynthesis (2/5 steps found)
- butanol and isobutanol biosynthesis (engineered) (4/8 steps found)
- cytidine-5'-diphosphate-glycerol biosynthesis (1/4 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (6/17 steps found)
- L-tryptophan degradation V (side chain pathway) (1/13 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- 3-Chloroacrylic acid degradation
- Alkaloid biosynthesis I
- Carotenoid biosynthesis - General
- Drug metabolism - cytochrome P450
- Fatty acid metabolism
- Glycine, serine and threonine metabolism
- Glycolysis / Gluconeogenesis
- Insect hormone biosynthesis
- Metabolism of xenobiotics by cytochrome P450
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Retinol metabolism
- Trinitrotoluene degradation
- Tyrosine metabolism
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-, 1.1.1.1
Use Curated BLAST to search for 1.-.-.- or 1.1.1.1 or 1.1.1.306
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1I2G224 at UniProt or InterPro
Protein Sequence (353 amino acids)
>ABZR86_RS07020 NAD(P)-dependent alcohol dehydrogenase (Dyella japonica UNC79MFTsu3.2) MALTIQGYAAQSATTPLAPHRFERRDPRPDDVVIDILYCGVCHSDIHQARNEWHNSIYPM VPGHEIIGRVSAVGAQVSKFKVGDMVGVGCMVDSCQHCGACHAGLEQYCVEGATWTYNGM DRRDGLPTFGGYSERIVSSDKFVVSISDKLDPKAAAPLLCAGITTWSPLRHWKIGQGSRV AIVGLGGLGHMGLKFAKAMGADVTLFTRTPDKEAEARRLGADHVVLSTDPAQMKAVSRAF DFILDTVPSPHDLNPYLETLDIDGTLCLVGLLEPIEPAVAAHNVVLGRRSIAGSGIGGIA ETQEMLDYCAEHGIVSDIEMIDIQDINKAYERMLKSDVRYRFVIDLASLKKAA