Protein Info for ABZR86_RS06815 in Dyella japonica UNC79MFTsu3.2

Annotation: exodeoxyribonuclease VII large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 PF13742: tRNA_anti_2" amino acids 18 to 108 (91 residues), 101 bits, see alignment E=5.4e-33 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 18 to 358 (341 residues), 435.5 bits, see alignment E=1.1e-134 PF01336: tRNA_anti-codon" amino acids 35 to 109 (75 residues), 47.1 bits, see alignment E=2.8e-16 PF02601: Exonuc_VII_L" amino acids 131 to 443 (313 residues), 361.4 bits, see alignment E=8.1e-112

Best Hits

Swiss-Prot: 56% identical to EX7L_XANAC: Exodeoxyribonuclease 7 large subunit (xseA) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 58% identity to psu:Psesu_1980)

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1YBP5 at UniProt or InterPro

Protein Sequence (449 amino acids)

>ABZR86_RS06815 exodeoxyribonuclease VII large subunit (Dyella japonica UNC79MFTsu3.2)
MHAPDAPTPPSRHILTPSTLNRLVRDLLEDALPLVWIEGELSNVARPASGHLYFTLKDAN
AQVRCAMFRPKAVGLRFRPVDGTHVLVRARVGLYEPRGEFQLVAEHMEPAGEGALQREFE
QLKARLDAEGLFDRARKRPLPAFARRIGVITSATGAAVRDVLSVLSRRWPLAEVEVLPVP
VQGREAPPAIVSMLRRASASGRYDVLLLTRGGGSLEDLWAFNDEQVARAVHASAVPVVSA
VGHEVDFSIADFVADLRAPTPSAAAELLVPDAASLERHLRQLRQRLATLQQRRLHALIQR
TDHLLARLQAQRPQTRLSRDRERLAHLRHRLAVAMRETLRESSRRLERDHARLLTRHPRQ
RLPLYAQQLAQQDRRLRQAIQRILERHRAALGQSARALHAVSPLATLERGYAILFDEQGR
VIRTAAAVAPDARVRARLADGELVLKNEA