Protein Info for ABZR86_RS06760 in Dyella japonica UNC79MFTsu3.2

Annotation: histidine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 TIGR00442: histidine--tRNA ligase" amino acids 9 to 438 (430 residues), 405.8 bits, see alignment E=1.1e-125 PF13393: tRNA-synt_His" amino acids 12 to 341 (330 residues), 126.5 bits, see alignment E=2e-40 PF00587: tRNA-synt_2b" amino acids 76 to 220 (145 residues), 31.3 bits, see alignment E=3.1e-11 PF03129: HGTP_anticodon" amino acids 361 to 447 (87 residues), 63.6 bits, see alignment E=2.4e-21

Best Hits

Swiss-Prot: 69% identical to SYH_XANOP: Histidine--tRNA ligase (hisS) from Xanthomonas oryzae pv. oryzae (strain PXO99A)

KEGG orthology group: K01892, histidyl-tRNA synthetase [EC: 6.1.1.21] (inferred from 70% identity to xal:XALc_1250)

Predicted SEED Role

"Histidyl-tRNA synthetase (EC 6.1.1.21)" (EC 6.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1YAP1 at UniProt or InterPro

Protein Sequence (457 amino acids)

>ABZR86_RS06760 histidine--tRNA ligase (Dyella japonica UNC79MFTsu3.2)
MALTQARTMPGVLELLPLDQIAFQRVLDTIRRNYERFGFLPVETPVMEYSDVLLTKTGGE
TERQVYFVQSTGSLEQGEKPELALRFDLTVPLARYVAEHEHDLSFPFRRYQMQRVYRGER
AQRGRFREFYQCDIDVIGKDGLSVRYDAELPAVIYSVFRELNIGAFTIQLNNRKLMRGFF
ESLGVLDAEQQTLVLREVDKLDKRGADYVRETLTGTNFGLAAEVADKILAFVQVRSSSLQ
QALEQLDALGPGPESMEQGRAELKEVLGLIRDFGVPESHFALNLSIARGLDYYTGTVYET
TLNDYPQIGSICSGGRYENLAGQYTKSRLPGVGISIGLTRLYWQLREAGLINTARSTVEV
LVTQMDEARMPAYLALASELRGAGIATEVVLEGGKLARQFKYADRAGIRFVLVLGEDELA
KGVVTVKDMRRQDQFEVARAELIKTLRVELAQAEIAP