Protein Info for ABZR86_RS06745 in Dyella japonica UNC79MFTsu3.2

Annotation: DUF998 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 25 to 32 (8 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details PF06197: DUF998" amino acids 21 to 198 (178 residues), 50.5 bits, see alignment E=1.1e-17

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1YAF6 at UniProt or InterPro

Protein Sequence (209 amino acids)

>ABZR86_RS06745 DUF998 domain-containing protein (Dyella japonica UNC79MFTsu3.2)
MTPTRPAIILPTAHLLLFTVTAFALICGAAQFWRHDLDPIAVPLSIYLTGPGGAYVRLAY
YLISVGLLGFALGSYRATAPALRSRLASTLFAGAGLALPLVAITELFAGTPHENQARLVH
GLAAQATFLWLSFGMLLLSARWRRDPRLSAGTAPGWIIAWLATIMLWLQVFLRDLPHGLM
QKLTIALILVWLAWAARHMRRAALHQATD