Protein Info for ABZR86_RS06725 in Dyella japonica UNC79MFTsu3.2

Annotation: histidinol-phosphate transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 58% identical to HIS8_XANC5: Histidinol-phosphate aminotransferase (hisC) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K00817, histidinol-phosphate aminotransferase [EC: 2.6.1.9] (inferred from 59% identity to psu:Psesu_1818)

Predicted SEED Role

"Histidinol-phosphate aminotransferase (EC 2.6.1.9)" in subsystem Histidine Biosynthesis (EC 2.6.1.9)

MetaCyc Pathways

superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
superpathway of aromatic amino acid biosynthesis (17/18 steps found)
L-histidine biosynthesis (10/10 steps found)
superpathway of L-phenylalanine biosynthesis (10/10 steps found)
superpathway of L-tyrosine biosynthesis (9/10 steps found)
L-phenylalanine biosynthesis I (3/3 steps found)
L-tyrosine degradation I (4/5 steps found)
3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
L-tyrosine biosynthesis I (2/3 steps found)
L-tyrosine degradation II (1/2 steps found)
atromentin biosynthesis (1/2 steps found)
L-phenylalanine degradation III (2/4 steps found)
L-tyrosine degradation III (2/4 steps found)
L-phenylalanine degradation II (anaerobic) (1/3 steps found)
L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
superpathway of plastoquinol biosynthesis (2/5 steps found)
4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
superpathway of chorismate metabolism (38/59 steps found)
rosmarinic acid biosynthesis I (1/10 steps found)
(S)-reticuline biosynthesis I (1/11 steps found)
superpathway of rosmarinic acid biosynthesis (1/14 steps found)
anaerobic aromatic compound degradation (Thauera aromatica) (1/27 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1YA20 at UniProt or InterPro

Protein Sequence (353 amino acids)

>ABZR86_RS06725 histidinol-phosphate transaminase (Dyella japonica UNC79MFTsu3.2)
MSVLDLARPELRAMQPYSSARMEASGGAILLNANESAWAPAGEAGRGCNRYPDPQPAALL
RALAALYGVREEQLLVGRGSDEAIDLLVRAFCRAGRDAIAIQPPTFGMYSVCARIQDAGI
VEVPLAADFTVDADALLAALTPAVKLVFVCTPNNPTGQPVPRATIERLARELAGRALLVV
DEAYVEFADGGSVAGLIDTYDNLAVLRTLSKAWALAGARIGTLLAHAEVIALLRKIIPPY
PLPLPCVTAALEGLSAQGQAEAAEHIRIVRAERARMTPALAALPGVREVLPSQANFLAVR
FDDAGAAYQRLFAAGIVVRDVRRYPNLGDALRITIGTPAENARVLDVLNGDRA