Protein Info for ABZR86_RS06715 in Dyella japonica UNC79MFTsu3.2

Annotation: imidazole glycerol phosphate synthase subunit HisH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01855: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit
  • amino acids 3 to 195 (193 residues), 216.8 bits, E=1.2e-68
• PF00117: GATase
  • amino acids 4 to 194 (191 residues), 70.4 bits, E=8.4e-24

Best Hits

Swiss-Prot: 59% identical to HIS5_XYLFA: Imidazole glycerol phosphate synthase subunit HisH (hisH) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K02501, glutamine amidotransferase [EC: 2.4.2.-] (inferred from 61% identity to xal:XALc_1257)

Predicted SEED Role

"Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-)" in subsystem Histidine Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.-

Sequence Analysis Tools

See A0A1I1Y9U7 at UniProt or InterPro

Protein Sequence (196 amino acids)

>ABZR86_RS06715 imidazole glycerol phosphate synthase subunit HisH (Dyella japonica UNC79MFTsu3.2)
MAVVLVDAGGTNIGSVRYALQRLGVDAALTSDANAIRQADRVILPGVGAAGPGMARLREL
GLVELIRSLTQPVLGVCLGMQLLFERSEEGATECLAVIPGAASRFAEAPGLRVPHMGWNR
LRVERAHPLVAGLGTDAWAYFVHSYAVPANDSTLATADFGGAFSAVVARGNFHGMQFHPE
RSAGVGARLLKNFLEL