Protein Info for ABZR86_RS06705 in Dyella japonica UNC79MFTsu3.2

Annotation: imidazole glycerol phosphate synthase subunit HisF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00735: imidazoleglycerol phosphate synthase, cyclase subunit
  • amino acids 1 to 255 (255 residues), 324.2 bits, E=2.5e-101
• PF00977: His_biosynth
  • amino acids 5 to 238 (234 residues), 232.6 bits, E=4.4e-73
• PF01207: Dus
  • amino acids 30 to 115 (86 residues), 22.5 bits, E=5.9e-09

Best Hits

Swiss-Prot: 78% identical to HIS6_XANC8: Imidazole glycerol phosphate synthase subunit HisF (hisF) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K02500, cyclase [EC: 4.1.3.-] (inferred from 83% identity to psu:Psesu_1814)

MetaCyc: 64% identical to imidazole glycerol phosphate synthase subunit HisF (Escherichia coli K-12 substr. MG1655)
GLUTAMIDOTRANS-RXN [EC: 4.3.2.10]

Predicted SEED Role

"Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)" in subsystem Histidine Biosynthesis (EC 4.1.3.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• L-histidine biosynthesis (10/10 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.- or 4.3.2.10

Sequence Analysis Tools

See A0A1I1Y9P8 at UniProt or InterPro

Protein Sequence (256 amino acids)

>ABZR86_RS06705 imidazole glycerol phosphate synthase subunit HisF (Dyella japonica UNC79MFTsu3.2)
MLSRRIIPCLDVRDGKVVKGVRFRDHVVMGEIVELALRYRDEGADELVFYDITASPEGRS
VDRGWVERVARAIDIPFCVAGGIRSVEDAREVLHAGADKISVNSPALERPALIGELAAAF
GVQCVVVGVDSLRDADGEWRVRQYTGDPTKTQALARRTLDWIDEAQRLGAGEIVLNCMGS
DGVREGYDLEQLHAARALCRVPLVASGGAGAPEHFRDAFAVADVDGALAASVFHSGAIAI
PSLKQYLRRAGIATRL