Protein Info for ABZR86_RS06690 in Dyella japonica UNC79MFTsu3.2

Annotation: acireductone synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00702: Hydrolase
  • amino acids 4 to 198 (195 residues), 45.7 bits, E=5.2e-16
• TIGR01691: 2,3-diketo-5-methylthio-1-phosphopentane phosphatase
  • amino acids 4 to 225 (222 residues), 276.5 bits, E=2.2e-86
• TIGR01549: HAD hydrolase, family IA, variant 1
  • amino acids 119 to 198 (80 residues), 27 bits, E=7.7e-10

Best Hits

Swiss-Prot: 57% identical to MTNC_ALCBS: Enolase-phosphatase E1 (mtnC) from Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)

KEGG orthology group: K09880, enolase-phosphatase E1 [EC: 3.1.3.77] (inferred from 58% identity to srs:SerAS12_0867)

Predicted SEED Role

"2,3-diketo-5-methylthiopentyl-1-phosphate enolase-phosphatase (EC 3.1.3.77)" in subsystem Methionine Salvage (EC 3.1.3.77)

MetaCyc Pathways

• L-methionine salvage cycle III (11/11 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (7/7 steps found)
• L-methionine salvage cycle I (bacteria and plants) (10/12 steps found)
• L-methionine salvage cycle II (plants) (8/11 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.77

Sequence Analysis Tools

See A0A1I1Y9T8 at UniProt or InterPro

Protein Sequence (228 amino acids)

>ABZR86_RS06690 acireductone synthase (Dyella japonica UNC79MFTsu3.2)
MTVIRAIVTDIEGTTSSISFVKDVLFPYARKRLPAYVETHVDTPELQHWLHEAAKEAGLV
EASRQEVIDLLLRWIDEDRKSTALKALQGMIWKDGYASGEYRAHVYPEVAARLRAWRGDG
LHLYVYSSGSVAAQKLFFQYSEAGDLTPLFGGYFDTETGPKREQASYEKIAAAIGEQPEH
LLFLSDIVEELDAAKAAGFHTAWLLRPPLAMPAEPRHPAYTDFDAIAP