Protein Info for ABZR86_RS06670 in Dyella japonica UNC79MFTsu3.2

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 transmembrane" amino acids 31 to 54 (24 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 233 to 251 (19 residues), see Phobius details amino acids 272 to 296 (25 residues), see Phobius details amino acids 317 to 340 (24 residues), see Phobius details amino acids 370 to 388 (19 residues), see Phobius details amino acids 394 to 416 (23 residues), see Phobius details amino acids 427 to 446 (20 residues), see Phobius details amino acids 452 to 470 (19 residues), see Phobius details PF13520: AA_permease_2" amino acids 28 to 448 (421 residues), 194.3 bits, see alignment E=5.5e-61 PF00324: AA_permease" amino acids 33 to 451 (419 residues), 133.6 bits, see alignment E=1.3e-42 PF13906: AA_permease_C" amino acids 424 to 474 (51 residues), 30.4 bits, see alignment 5e-11

Best Hits

Swiss-Prot: 45% identical to YHDG_BACSU: Uncharacterized amino acid permease YhdG (yhdG) from Bacillus subtilis (strain 168)

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 72% identity to xcb:XC_2368)

Predicted SEED Role

"Amino acid transporters"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1Y8T3 at UniProt or InterPro

Protein Sequence (480 amino acids)

>ABZR86_RS06670 amino acid permease (Dyella japonica UNC79MFTsu3.2)
MLKQLFARKTDFSDADDCHGGPSLRRTLGKWGITALGIGAVIGTGIFVVTGQAAAEHAGP
AVLISFMLAAICSGFTALCYAEFATLIPISGSSYSYAYATLGELVAWFIGWNMVLEYGIS
ASAVAASWTGYFTSLLDHVGIHLPVALTEAPLAFKDGHLVTTGHLLNLPAVAIVLALTWL
CYVGIRESSGLNVLMVALKVGLIIVVVVAGYRYVDPANWHPFIPAEQEPGKYGWSGIMRG
AAMVFFAYIGFEATSTAAQECKNPQKDLPFGTLVSLVICTVLYLAMAAVLTGLIPYTELG
TSEPVVTAIRNHPELGWLRLVVEIGAMIGLSSVILVMIIAQPRIFMIMSRDGLLPPVFNR
IHPKHRTPHLNTVITGIGIAILAAVFPLDLLADLTSMGTLIAFVAVCAGVLILRYTAPEL
PRLFRVPAAWFVCTAGVFSCLALLYFMAWFNWLLMIIWTAIGLAIYFGYGMRHSRLRRAS