Protein Info for ABZR86_RS06655 in Dyella japonica UNC79MFTsu3.2

Annotation: 3-hydroxyanthranilate 3,4-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06052: 3-HAO
  • amino acids 5 to 151 (147 residues), 229.1 bits, E=1.7e-72
• TIGR03037: 3-hydroxyanthranilate 3,4-dioxygenase
  • amino acids 7 to 164 (158 residues), 256.1 bits, E=6.3e-81
• PF07883: Cupin_2
  • amino acids 42 to 95 (54 residues), 35 bits, E=9.3e-13

Best Hits

Swiss-Prot: 75% identical to 3HAO_XANC8: 3-hydroxyanthranilate 3,4-dioxygenase (nbaC) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K00452, 3-hydroxyanthranilate 3,4-dioxygenase [EC: 1.13.11.6] (inferred from 75% identity to xcb:XC_2679)

MetaCyc: 48% identical to 3-hydroxyanthranilate 3,4-dioxygenase subunit (Pseudomonas fluorescens KU-7)
3-hydroxyanthranilate 3,4-dioxygenase. [EC: 1.13.11.6]

Predicted SEED Role

"3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6)" in subsystem NAD and NADP cofactor biosynthesis global or Quinolinic acid and its derivatives (EC 1.13.11.6)

MetaCyc Pathways

• NAD de novo biosynthesis II (from tryptophan) (8/9 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• L-tryptophan degradation to 2-amino-3-carboxymuconate semialdehyde (4/5 steps found)
• superpathway of NAD biosynthesis in eukaryotes (10/14 steps found)
• L-tryptophan degradation III (eukaryotic) (10/15 steps found)
• 2-nitrobenzoate degradation I (4/7 steps found)
• L-tryptophan degradation IX (7/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (6/12 steps found)
• L-tryptophan degradation XI (mammalian, via kynurenine) (11/23 steps found)

KEGG Metabolic Maps

• Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.6

Sequence Analysis Tools

See A0A1I1Y8I5 at UniProt or InterPro

Protein Sequence (173 amino acids)

>ABZR86_RS06655 3-hydroxyanthranilate 3,4-dioxygenase (Dyella japonica UNC79MFTsu3.2)
MALPPPLDLQRWIDEHRHLLKPPVGNKCIVDGDFIVMIVGGPNARTDYHYDEGPEFFYQL
EGEMVLKVQDDGAARDIPIRAGQMFYLPPRVPHSPQRMPDSIGLVIERRRLAGEQDGLMW
FCQQCNHKLYEEYFTLDSIERDFPPVFERFYRSLEARTCTQCGTVHPAPAKYA