Protein Info for ABZR86_RS06635 in Dyella japonica UNC79MFTsu3.2

Annotation: 3-deoxy-8-phosphooctulonate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF00793: DAHP_synth_1" amino acids 7 to 267 (261 residues), 248.1 bits, see alignment E=4e-78 TIGR01362: 3-deoxy-8-phosphooctulonate synthase" amino acids 13 to 268 (256 residues), 426.6 bits, see alignment E=1.4e-132

Best Hits

Swiss-Prot: 86% identical to KDSA_STRM5: 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K01627, 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC: 2.5.1.55] (inferred from 86% identity to smt:Smal_1449)

MetaCyc: 52% identical to 3-deoxy-8-phosphooctulonate synthase subunit (Arabidopsis thaliana col)
3-deoxy-8-phosphooctulonate synthase. [EC: 2.5.1.55]

Predicted SEED Role

"2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase (EC 2.5.1.55)" in subsystem KDO2-Lipid A biosynthesis (EC 2.5.1.55)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.55

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1YCB8 at UniProt or InterPro

Protein Sequence (277 amino acids)

>ABZR86_RS06635 3-deoxy-8-phosphooctulonate synthase (Dyella japonica UNC79MFTsu3.2)
MKLCGFAVGQDQPLFLIAGPCVVESEQLQVDTAGKLKEITGRLGINFIFKSSFDKANRSS
GSSFRGLGMEEGLRILGEVKRQVGVPVLTDVHEYTPFAEVASVVDVLQTPAFLCRQTDFI
QAVARAGKPVNIKKGQFLAPWDMKNVVDKAKAVGNDDILVCERGASFGYNNLVSDMRSLA
VMRDTGCPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAIAVGVAGLFAETHPDPSKA
LSDGPNAWPLGKMEALLETLMELDAVTKRHGFLEQTL