Protein Info for ABZR86_RS06455 in Dyella japonica UNC79MFTsu3.2

Annotation: cytochrome c-type biogenesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 108 to 129 (22 residues), see Phobius details PF03918: CcmH" amino acids 14 to 146 (133 residues), 168.9 bits, see alignment E=2.1e-54

Best Hits

Swiss-Prot: 49% identical to CCMH_PSEFL: Cytochrome c-type biogenesis protein CcmH (ccmH) from Pseudomonas fluorescens

KEGG orthology group: K02200, cytochrome c-type biogenesis protein CcmH (inferred from 68% identity to xcb:XC_2574)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmL" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1Y5B9 at UniProt or InterPro

Protein Sequence (156 amino acids)

>ABZR86_RS06455 cytochrome c-type biogenesis protein (Dyella japonica UNC79MFTsu3.2)
MNAVFRRALFALALALCCGALNAQAIDPLPFKDHAEETRFQQLTRELRCLVCQNENLADS
NADLARDLRHQVFELMRQGKSDAQIKQYLVDRYSDFVLYDPPVQGSTLLLWFGPLAILLA
GAAVVVVTVRRRSRAQAPASNQSANDSSPNDEGDDW