Protein Info for ABZR86_RS06410 in Dyella japonica UNC79MFTsu3.2

Annotation: NAD(P)/FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01494: FAD_binding_3
  • amino acids 10 to 178 (169 residues), 56.4 bits, E=4.7e-19
  • amino acids 299 to 352 (54 residues), 42.6 bits, 7.5e-15
• PF13450: NAD_binding_8
  • amino acids 12 to 41 (30 residues), 26 bits, see alignment (E = 1.4e-09)

Predicted SEED Role

"Kynurenine 3-monooxygenase (EC 1.14.13.9)" in subsystem NAD and NADP cofactor biosynthesis global (EC 1.14.13.9)

MetaCyc Pathways

• NAD de novo biosynthesis II (from tryptophan) (8/9 steps found)
• L-tryptophan degradation to 2-amino-3-carboxymuconate semialdehyde (4/5 steps found)
• superpathway of NAD biosynthesis in eukaryotes (10/14 steps found)
• 3-hydroxy-4-methyl-anthranilate biosynthesis II (3/5 steps found)
• L-tryptophan degradation III (eukaryotic) (10/15 steps found)
• L-tryptophan degradation IX (7/12 steps found)
• 3-hydroxy-4-methyl-anthranilate biosynthesis I (2/6 steps found)
• L-tryptophan degradation XI (mammalian, via kynurenine) (11/23 steps found)

KEGG Metabolic Maps

• Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.9

Sequence Analysis Tools

See A0A1I1Y4I1 at UniProt or InterPro

Protein Sequence (470 amino acids)

>ABZR86_RS06410 NAD(P)/FAD-dependent oxidoreductase (Dyella japonica UNC79MFTsu3.2)
MASTQQPSITLIGGGLVGALLAQQLARRGFPVEVYEKRADPRRAGFTGGRSINLALAERG
LQALRTAGLADDVLTRAVMMRGRMVHTRDGRSGLQRYGVDDSEVIWSVSRGALNMLLLDA
AEAAGVRFHFGQSLVAADFDARRVRLADEQGVERSIDAGVLIGADGAGSALRAAMHAYRP
LGERIEPLGHAYKELEIPPAGQLPAGLLGDSGGHDQFAIEPHALHIWPRGGYMCIALPNT
EGSFTVTLFLPAQGAHPSFATLPDAAAAETFFRDDFPDLLPLIPDFADDYGSHPVGTLST
LYLERWHIDGRALLIGDAAHAIVPFHGQGMNCGFEDTVALAALLAEAPQDVADAFAEFQR
VRQPNANAIAAMALENYIEMRDSVADPHYLAKRELGVLLAERAPQHFMARYRMVTFTHLP
YAYAYDRGRAQDQLLQQLLRGSTDPRSVDLDAATTALQATLPPLPSLRHG