Protein Info for ABZR86_RS06410 in Dyella japonica UNC79MFTsu3.2

Annotation: NAD(P)/FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF01494: FAD_binding_3" amino acids 10 to 178 (169 residues), 56.4 bits, see alignment E=4.7e-19 amino acids 299 to 352 (54 residues), 42.6 bits, see alignment 7.5e-15 PF13450: NAD_binding_8" amino acids 12 to 41 (30 residues), 26 bits, see alignment (E = 1.4e-09)

Best Hits

Predicted SEED Role

"Kynurenine 3-monooxygenase (EC 1.14.13.9)" in subsystem NAD and NADP cofactor biosynthesis global (EC 1.14.13.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1Y4I1 at UniProt or InterPro

Protein Sequence (470 amino acids)

>ABZR86_RS06410 NAD(P)/FAD-dependent oxidoreductase (Dyella japonica UNC79MFTsu3.2)
MASTQQPSITLIGGGLVGALLAQQLARRGFPVEVYEKRADPRRAGFTGGRSINLALAERG
LQALRTAGLADDVLTRAVMMRGRMVHTRDGRSGLQRYGVDDSEVIWSVSRGALNMLLLDA
AEAAGVRFHFGQSLVAADFDARRVRLADEQGVERSIDAGVLIGADGAGSALRAAMHAYRP
LGERIEPLGHAYKELEIPPAGQLPAGLLGDSGGHDQFAIEPHALHIWPRGGYMCIALPNT
EGSFTVTLFLPAQGAHPSFATLPDAAAAETFFRDDFPDLLPLIPDFADDYGSHPVGTLST
LYLERWHIDGRALLIGDAAHAIVPFHGQGMNCGFEDTVALAALLAEAPQDVADAFAEFQR
VRQPNANAIAAMALENYIEMRDSVADPHYLAKRELGVLLAERAPQHFMARYRMVTFTHLP
YAYAYDRGRAQDQLLQQLLRGSTDPRSVDLDAATTALQATLPPLPSLRHG