Protein Info for ABZR86_RS06400 in Dyella japonica UNC79MFTsu3.2

Annotation: polyhydroxyalkanoate synthesis repressor PhaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 TIGR01848: polyhydroxyalkanoate synthesis repressor PhaR" amino acids 6 to 112 (107 residues), 171.1 bits, see alignment E=3.7e-55 PF07879: PHB_acc_N" amino acids 7 to 67 (61 residues), 103.1 bits, see alignment E=6.9e-34 PF05233: PHB_acc" amino acids 71 to 110 (40 residues), 63.7 bits, see alignment E=1.3e-21

Best Hits

Swiss-Prot: 51% identical to YPH4_THIVI: Uncharacterized protein in phbA 5'region (Fragment) from Thiocystis violacea

KEGG orthology group: None (inferred from 76% identity to sml:Smlt3326)

Predicted SEED Role

"PhbF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1Y4D1 at UniProt or InterPro

Protein Sequence (161 amino acids)

>ABZR86_RS06400 polyhydroxyalkanoate synthesis repressor PhaR (Dyella japonica UNC79MFTsu3.2)
MAQTIRIIKKYPNRRLYDTEISSYITLEEVRQLVIDGETFEVRDAKSGDDLTRSVLLQII
SEHEEKGQPMLSPQLLSHIIRFYGDSLQGFMGPYLERSLQVFLDQQQQFRNQLNSLLGQT
PWSMLNDLTQRNMDAWKSMQSGLIDAATQASSATKPGGAKK