Protein Info for ABZR86_RS06345 in Dyella japonica UNC79MFTsu3.2

Annotation: succinate dehydrogenase, cytochrome b556 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 transmembrane" amino acids 25 to 50 (26 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details PF01127: Sdh_cyt" amino acids 4 to 119 (116 residues), 111.1 bits, see alignment E=3.9e-36 TIGR02970: succinate dehydrogenase, cytochrome b556 subunit" amino acids 5 to 122 (118 residues), 129.7 bits, see alignment E=3.4e-42 PF02300: Fumarate_red_C" amino acids 22 to 71 (50 residues), 26.1 bits, see alignment E=8.3e-10

Best Hits

Swiss-Prot: 44% identical to DHSC_RICFE: Succinate dehydrogenase cytochrome b556 subunit (sdhC) from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)

KEGG orthology group: K00241, succinate dehydrogenase cytochrome b-556 subunit (inferred from 62% identity to smt:Smal_1535)

Predicted SEED Role

"Succinate dehydrogenase cytochrome b-556 subunit" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1Y3G6 at UniProt or InterPro

Protein Sequence (130 amino acids)

>ABZR86_RS06345 succinate dehydrogenase, cytochrome b556 subunit (Dyella japonica UNC79MFTsu3.2)
MADTRRPLSPHLQIYKWQVQMVTSILHRATGIALAVGTLLIMWGLLALAGGESSFNQFKT
CIGSPIGLVLMFGWSWALFFHLCNGIRHLVQDAGAGYAIAQFVRSSWLSVIGSLLLTVLV
WAYVLVGGAA