Protein Info for ABZR86_RS06240 in Dyella japonica UNC79MFTsu3.2

Annotation: YbaB/EbfC family nucleoid-associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 TIGR00103: DNA-binding protein, YbaB/EbfC family" amino acids 2 to 103 (102 residues), 112.6 bits, see alignment E=4.4e-37 PF02575: YbaB_DNA_bd" amino acids 9 to 98 (90 residues), 107.7 bits, see alignment E=1.3e-35

Best Hits

Swiss-Prot: 64% identical to Y1509_ALKEH: Nucleoid-associated protein Mlg_1509 (Mlg_1509) from Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)

KEGG orthology group: K09747, hypothetical protein (inferred from 66% identity to tgr:Tgr7_1074)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1Y1Z6 at UniProt or InterPro

Protein Sequence (107 amino acids)

>ABZR86_RS06240 YbaB/EbfC family nucleoid-associated protein (Dyella japonica UNC79MFTsu3.2)
MRGQIGQLMQQAQRMQEEMKRAQEEIAKLEVTGTSGGGLVTVVMSGAHEVRRVQIDRKLF
ADDPEMAEDLVAAAINDAVNKVGEASKNKLGGVTSGMNLPPGFKMPF