Protein Info for ABZR86_RS06230 in Dyella japonica UNC79MFTsu3.2

Annotation: histidine triad nucleotide-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF11969: DcpS_C
  • amino acids 4 to 105 (102 residues), 81.3 bits, E=7.4e-27
• PF01230: HIT
  • amino acids 11 to 108 (98 residues), 95.4 bits, E=2.7e-31

Best Hits

Swiss-Prot: 66% identical to Y1390_SYNE7: Uncharacterized HIT-like protein Synpcc7942_1390 (Synpcc7942_1390) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: None (inferred from 74% identity to psu:Psesu_2014)

MetaCyc: 52% identical to purine nucleoside phosphoramidase (Escherichia coli K-12 substr. MG1655)
3.9.1.-

Predicted SEED Role

"Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) (EC 3.6.1.17)" (EC 3.6.1.17)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.17

Sequence Analysis Tools

See A0A1I1Y1A7 at UniProt or InterPro

Protein Sequence (114 amino acids)

>ABZR86_RS06230 histidine triad nucleotide-binding protein (Dyella japonica UNC79MFTsu3.2)
MADTIFGKIIRREIPADIVYEDDDVLAFRDLNPQAPVHVLFVPKRAIATLDEAGPGDAEL
LGKLLLATAAYAREQGLAKDGYRTVINCNEHGGQTVFHLHVHLLAGRRMHWPPG