Protein Info for ABZR86_RS06180 in Dyella japonica UNC79MFTsu3.2

Annotation: beta-ketoacyl-ACP synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 5 to 324 (320 residues), 450.2 bits, see alignment E=1.8e-139 PF00108: Thiolase_N" amino acids 39 to 148 (110 residues), 34.3 bits, see alignment E=2.6e-12 PF08545: ACP_syn_III" amino acids 109 to 186 (78 residues), 116.2 bits, see alignment E=7.6e-38 PF08541: ACP_syn_III_C" amino acids 236 to 325 (90 residues), 118.2 bits, see alignment E=2.2e-38

Best Hits

Swiss-Prot: 72% identical to FABH_XANCP: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 75% identity to sml:Smlt1026)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1Y0M2 at UniProt or InterPro

Protein Sequence (325 amino acids)

>ABZR86_RS06180 beta-ketoacyl-ACP synthase III (Dyella japonica UNC79MFTsu3.2)
MAQIYSRIIATGSALPERVVTNADLEKFVDTSDEWIRERTGIRQRHIAADGETTGDLATQ
AAQRALEAAGVKASELDLIVMGTTTPDIIFPSTACLVQHRLGANGCAAFDVNAACSGFVY
ALGVADKFIRSGQSKKVLVIGAETLTRMLDWDDRTTCVLFGDGAGAVVLEASSEPGIYAT
CLHADGGHKELLYNPVGVSVGFKDNEKNHGVLVRMAGREVFKVAVKTLDALVEETLTAAG
MHADQLDWLIPHQANLRIIEATAKRLSMPMDKVIVTVDKHANTSAGSVPLALDYAVRSGK
VQRGQNLLLEAFGGGFTWASALLRY