Protein Info for ABZR86_RS06110 in Dyella japonica UNC79MFTsu3.2

Annotation: NADH-quinone oxidoreductase subunit B family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 TIGR01957: NADH-quinone oxidoreductase, B subunit" amino acids 38 to 178 (141 residues), 254.3 bits, see alignment E=1.5e-80 PF01058: Oxidored_q6" amino acids 63 to 172 (110 residues), 97.8 bits, see alignment E=2e-32

Best Hits

Swiss-Prot: 87% identical to NUOB_STRMK: NADH-quinone oxidoreductase subunit B (nuoB) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 87% identity to smt:Smal_2830)

MetaCyc: 60% identical to ferredoxin-menaquinone dehydrogenase subunit B (Helicobacter pylori 26695)
7.1.1.-

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1XYX5 at UniProt or InterPro

Protein Sequence (185 amino acids)

>ABZR86_RS06110 NADH-quinone oxidoreductase subunit B family protein (Dyella japonica UNC79MFTsu3.2)
MGVISSLDRVMHNPQPLNVVDDILRPAGDNPVIQRGAVTTTVDALMNWARTGSMWPMTFG
LACCAVEMMHAGAARLDLDRYGVIFRPSPRQSDVMIVAGTLVNKMAPALRKVYDQMPDPK
WVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIHGILQLQKKIRRTS
TIARS