Protein Info for ABZR86_RS06090 in Dyella japonica UNC79MFTsu3.2

Annotation: NADH-quinone oxidoreductase subunit NuoF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 TIGR01959: NADH oxidoreductase (quinone), F subunit" amino acids 13 to 421 (409 residues), 628 bits, see alignment E=2.5e-193 PF01512: Complex1_51K" amino acids 54 to 225 (172 residues), 147.4 bits, see alignment E=4.8e-47 PF10531: SLBB" amino acids 249 to 297 (49 residues), 38.6 bits, see alignment 1.2e-13 PF10589: NADH_4Fe-4S" amino acids 337 to 419 (83 residues), 113.4 bits, see alignment E=5.5e-37

Best Hits

Swiss-Prot: 56% identical to NUOF_RICPR: NADH-quinone oxidoreductase subunit F (nuoF) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: K00335, NADH dehydrogenase I subunit F [EC: 1.6.5.3] (inferred from 84% identity to xac:XAC2699)

MetaCyc: 47% identical to NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (Homo sapiens)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain F (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1XY96 at UniProt or InterPro

Protein Sequence (436 amino acids)

>ABZR86_RS06090 NADH-quinone oxidoreductase subunit NuoF (Dyella japonica UNC79MFTsu3.2)
MAYGPAPQEHQVVYTTLHFDKPWAMDSYTQVGGYEAWKKILAEKPDPNALIEEIKKSNLR
GRGGAGFPTGLKWSFMPKGNMQKYILCNSDESEPGTCKDRDILRFNPHAVIEGMAIACYC
TGSTAAYNYLRGEFHHEPYEHFEEALKEAYAAGLLGKNIQGTGIDVDIYGALGAGAYICG
EETALMESLEGKKGQPRFKPPFPANFGLYGKPSTINNTETYASVPAILRKGADWFLAQSK
TKNGGPKIFSVSGCVQKGGNFEVPLGTTFDELLEMAGGLRPGRKLKGAIPGGVSMPVLKA
EQLKGLPFDYDTLRDLKTGLGSGAIVVLDDTVCTVRFTRRISQFFHKESCGQCTPCREGT
GWMHRVLDRIVEGKGTMEDLHRLKAIAGQIEGHTICAFGEAAAWPVQGFLRQFWDEFEYY
IVNGRSIVDDQIGVAA