Protein Info for ABZR86_RS06030 in Dyella japonica UNC79MFTsu3.2

Annotation: transcription termination factor NusA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 PF08529: NusA_N" amino acids 4 to 128 (125 residues), 130.9 bits, see alignment E=5.9e-42 TIGR01953: transcription termination factor NusA" amino acids 5 to 347 (343 residues), 420.8 bits, see alignment E=3.6e-130 PF00575: S1" amino acids 135 to 199 (65 residues), 30.2 bits, see alignment E=1e-10 PF13184: KH_5" amino acids 234 to 301 (68 residues), 94.7 bits, see alignment E=6.1e-31 TIGR01954: transcription termination factor NusA, C-terminal duplication" amino acids 369 to 418 (50 residues), 71.3 bits, see alignment 5.4e-24 amino acids 442 to 489 (48 residues), 56.8 bits, see alignment 1.8e-19 PF14520: HHH_5" amino acids 434 to 489 (56 residues), 42.7 bits, see alignment 1.3e-14

Best Hits

Swiss-Prot: 57% identical to NUSA_COXBU: Transcription termination/antitermination protein NusA (nusA) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K02600, N utilization substance protein A (inferred from 79% identity to psu:Psesu_1830)

Predicted SEED Role

"Transcription termination protein NusA" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1XXC9 at UniProt or InterPro

Protein Sequence (499 amino acids)

>ABZR86_RS06030 transcription termination factor NusA (Dyella japonica UNC79MFTsu3.2)
MSKELLLVVDAVANEKGVPREVIFQAMEAALASAAKKRYPDEDPNIRVSIDRQNGEYETF
RRWEIIADDGEMESPYHQLRLMDAVDEREDAQIGEYIETQIENAEFGRIAAQAAKQVIVQ
RVREAERQQVVDAYKDRVGELITGIVKRVERGNVYLDLGGNAEAFIPRDKTIPRESHRVG
DRVRGYLAEVKSEIRGPQLFVSRAAPEFMIELFKLEVPEVGQGLVEIKGCARDPGDRAKI
AVVAHDSRTDPIGACIGMRGSRVQAVSNELNGERVDIITWHENQAQYVINAMAPAEVQSI
IMDEEKHSMDIAVAEDKLSQAIGRGGQNVRLASKLTGWQLNVMTQDQVAAKSEAEQEAAR
QLFMEKLEVDQEIANILVQEGFSSIEEIAYVPSAELLAVEGFDEDIVEELRARARDALLT
EALAVEEGVNEPSEELLALPGMSESIAYALAEREVATLDDLADLAVDDLIDIEGVDEDLA
AKLIMEARKPMIERLERGG