Protein Info for ABZR86_RS05940 in Dyella japonica UNC79MFTsu3.2
Annotation: YhdH/YhfP family quinone oxidoreductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 47% identical to YHFP_BACSU: Putative quinone oxidoreductase YhfP (yhfP) from Bacillus subtilis (strain 168)
KEGG orthology group: None (inferred from 67% identity to xal:XALc_0654)MetaCyc: 46% identical to acrylyl-CoA reductase (Escherichia coli K-12 substr. MG1655)
RXN-9087 [EC: 1.3.1.84]
Predicted SEED Role
"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)
MetaCyc Pathways
- superpathway of anaerobic sucrose degradation (17/19 steps found)
- heterolactic fermentation (14/18 steps found)
- 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
- acrylate degradation II (3/3 steps found)
- ethanol degradation II (3/3 steps found)
- pyruvate fermentation to ethanol II (2/2 steps found)
- pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
- acetaldehyde biosynthesis I (1/1 steps found)
- phytol degradation (3/4 steps found)
- L-isoleucine degradation II (2/3 steps found)
- L-leucine degradation III (2/3 steps found)
- L-methionine degradation III (2/3 steps found)
- L-valine degradation II (2/3 steps found)
- ethanol degradation I (1/2 steps found)
- mixed acid fermentation (11/16 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (13/19 steps found)
- superpathway of N-acetylneuraminate degradation (15/22 steps found)
- L-phenylalanine degradation III (2/4 steps found)
- L-tyrosine degradation III (2/4 steps found)
- salidroside biosynthesis (2/4 steps found)
- serotonin degradation (4/7 steps found)
- pyruvate fermentation to ethanol I (1/3 steps found)
- pyruvate fermentation to ethanol III (1/3 steps found)
- 3-hydroxypropanoate cycle (8/13 steps found)
- noradrenaline and adrenaline degradation (8/13 steps found)
- superpathway of fermentation (Chlamydomonas reinhardtii) (5/9 steps found)
- (S)-propane-1,2-diol degradation (2/5 steps found)
- acetylene degradation (anaerobic) (2/5 steps found)
- ethanolamine utilization (2/5 steps found)
- phenylethanol biosynthesis (2/5 steps found)
- butanol and isobutanol biosynthesis (engineered) (4/8 steps found)
- cytidine-5'-diphosphate-glycerol biosynthesis (1/4 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
- glyoxylate assimilation (6/13 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
- superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (6/17 steps found)
- L-tryptophan degradation V (side chain pathway) (1/13 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- 3-Chloroacrylic acid degradation
- Drug metabolism - cytochrome P450
- Fatty acid metabolism
- Glycine, serine and threonine metabolism
- Glycolysis / Gluconeogenesis
- Metabolism of xenobiotics by cytochrome P450
- Retinol metabolism
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.1
Use Curated BLAST to search for 1.1.1.1 or 1.3.1.84
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1I1XVX4 at UniProt or InterPro
Protein Sequence (332 amino acids)
>ABZR86_RS05940 YhdH/YhfP family quinone oxidoreductase (Dyella japonica UNC79MFTsu3.2) MTDLDFRAFRIHNDGSGYRGGIETMSTGALSAGQVLVKTAYSSVNYKDALAGTGKGKILR QYPLNGGIDAAGVVVASTDPKFKEGDAVLCTGSGLSETRDGGYGEYARFDAHWTIPLPAG LSLRESMVLGTAGFTAALALLQMEDNRQTPALGPIAVTGASGGVGMLAIDIFSRAGYQVH AISGKADHFDFLRSLGASACIDRRELVFSGKPMDSARFGGALDNVGGAMLAGLLPLVAPY GNVAICGNAGGIGFDSTVMPFIIRSVSLLGVASAGTARDQRERVWERLAGDWKPRHLDRI ATREVSLDQLPDVFERMLAGESFGRTVVRHEV