Protein Info for ABZR86_RS05895 in Dyella japonica UNC79MFTsu3.2

Annotation: phosphoadenylyl-sulfate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 69% identical to CYSH_XANC8: Phosphoadenosine phosphosulfate reductase (cysH) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 68% identity to psu:Psesu_0465)

MetaCyc: 63% identical to phosphoadenosine phosphosulfate reductase (Escherichia coli K-12 substr. MG1655)
Phosphoadenylyl-sulfate reductase (thioredoxin). [EC: 1.8.4.8]

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8)" in subsystem Cysteine Biosynthesis (EC 1.8.4.8)

MetaCyc Pathways

superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
superpathway of sulfate assimilation and cysteine biosynthesis (8/9 steps found)
assimilatory sulfate reduction I (4/4 steps found)
assimilatory sulfate reduction III (3/3 steps found)
superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
assimilatory sulfate reduction IV (3/4 steps found)

KEGG Metabolic Maps

Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1XUM5 at UniProt or InterPro

Protein Sequence (240 amino acids)

>ABZR86_RS05895 phosphoadenylyl-sulfate reductase (Dyella japonica UNC79MFTsu3.2)
MNGATLEAARHDPRALAELDTWLGALDAEERVAWALEHAPGAHALSSSFGAQAAVSLHLL
TRQRPQLPVILVDTGYLFPETYRFVDELRERLALNLHVYRSPIGTAWMESRHGRLWEQGV
EGLGRYNELRKVEPMRRALEELGIGSWFAGLRRGQSRSRERIPFLRLSQGRWKFHPIADW
TDRDVGRYLQRHDLPYHPLWEQGYVSIGDVHTTRPLEPGMDPEETRFFGLKRECGIHDLA