Protein Info for ABZR86_RS05875 in Dyella japonica UNC79MFTsu3.2

Annotation: cysteine synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR01136: cysteine synthase" amino acids 7 to 302 (296 residues), 393.9 bits, see alignment E=4.9e-122 PF00291: PALP" amino acids 7 to 290 (284 residues), 237.6 bits, see alignment E=9.9e-75 TIGR01139: cysteine synthase A" amino acids 7 to 302 (296 residues), 412.8 bits, see alignment E=7.8e-128

Best Hits

Swiss-Prot: 52% identical to CYSK_BACSU: Cysteine synthase (cysK) from Bacillus subtilis (strain 168)

KEGG orthology group: K01738, cysteine synthase A [EC: 2.5.1.47] (inferred from 83% identity to psu:Psesu_0459)

MetaCyc: 44% identical to O-acetylserine (thiol) lyase (Arabidopsis thaliana col)
Cysteine synthase. [EC: 2.5.1.47]

Predicted SEED Role

"Cysteine synthase (EC 2.5.1.47)" in subsystem Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.5.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1XUA7 at UniProt or InterPro

Protein Sequence (313 amino acids)

>ABZR86_RS05875 cysteine synthase A (Dyella japonica UNC79MFTsu3.2)
MIYDSILDTIGKTPVVKLHRLAPKHVELYVKVEAFNPAGSVKDRLALAIILDAEARGTIK
PGQTVVEATSGNTGVALAAVCAARGYPFVAVMTETFSIERRKLIRAYGGKVLLTPAAERG
SGMVRKAKELADKHGWFLARQFENPANPAYHRSTTAAEILRDFAGRRLDYFVTGWGTGGT
LTGVGEVLKVARPEVKVIASEPAGASLLAGKEWQPHKIQGWTPDFVPAVLNREVAQQILP
VDDVVARDTSRALAQKEGIFVGISSGATLAAALQVAKDAPEGSVLLAMLPDTGERYLSTF
LFEGVNEGSDEVE