Protein Info for ABZR86_RS05860 in Dyella japonica UNC79MFTsu3.2

Annotation: adenylosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR00928: adenylosuccinate lyase" amino acids 12 to 449 (438 residues), 415.7 bits, see alignment E=1.1e-128 PF00206: Lyase_1" amino acids 14 to 312 (299 residues), 205.6 bits, see alignment E=1.3e-64 PF08328: ASL_C" amino acids 331 to 445 (115 residues), 166 bits, see alignment E=3.1e-53

Best Hits

Swiss-Prot: 63% identical to PUR8_PSEAE: Adenylosuccinate lyase (purB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01756, adenylosuccinate lyase [EC: 4.3.2.2] (inferred from 78% identity to psu:Psesu_1780)

MetaCyc: 60% identical to adenylosuccinate lyase (Escherichia coli K-12 substr. MG1655)
Adenylosuccinate lyase. [EC: 4.3.2.2]; 4.3.2.2 [EC: 4.3.2.2]

Predicted SEED Role

"Adenylosuccinate lyase (EC 4.3.2.2)" in subsystem De Novo Purine Biosynthesis or Purine conversions (EC 4.3.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1XVX5 at UniProt or InterPro

Protein Sequence (455 amino acids)

>ABZR86_RS05860 adenylosuccinate lyase (Dyella japonica UNC79MFTsu3.2)
MSAHALTALSPLDGRYASKAQALRPIFSEYGLMHRRVHVEIEWLLALAADPGIAELPAFS
PAQIARLRDIAASFSVEDGERVKAIEATTNHDVKAIEYFIKERIGNDAALAQAKEFVHFA
CTSEDINNLSYALMLRDAQRQVLLPAFDAVIAKLRELAHANAALPMLSRTHGQTASPSTL
GKELANVVARLERQRKQLAAVEIPGKINGAVGNYNAHAITYPELDWRAFSQRFVESLGLD
YNPYTTQIEPHDGVAEYCDAVRRANIILIDLARDVWGYVSLGYFKQALKAGEVGSSTMPH
KVNPIDFENAEGNFGLANALLGHFAEKLPISRWQRDLTDSTVLRALGTAFGHTLVALESL
QKGLGKLNVNADRLAADLDASWEVLAEAVQTVMRRYGLPEPYEQLKALTRGQGITRDSMR
QFIAGLELPADAKQRLLELTPGGYVGLAEPLAREI