Protein Info for ABZR86_RS05690 in Dyella japonica UNC79MFTsu3.2

Annotation: RnfH family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 93 PF03658: Ub-RnfH" amino acids 5 to 87 (83 residues), 111.9 bits, see alignment E=7.7e-37

Best Hits

Swiss-Prot: 55% identical to Y3462_CHRVO: UPF0125 protein CV_3462 (CV_3462) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K09801, hypothetical protein (inferred from 55% identity to cvi:CV_3462)

Predicted SEED Role

"UPF0125 protein yfjF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1XR21 at UniProt or InterPro

Protein Sequence (93 amino acids)

>ABZR86_RS05690 RnfH family protein (Dyella japonica UNC79MFTsu3.2)
MAERIAVEVAYAEAGRQWVLPVQLPAGATVMQAIEASGLLEQVPGLAIDPARLGVFSRKA
APDQVLEDGDRVEIYRPLSLDPKEARRRRAQGT