Protein Info for ABZR86_RS05635 in Dyella japonica UNC79MFTsu3.2

Annotation: sodium:calcium antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details amino acids 121 to 150 (30 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details amino acids 254 to 277 (24 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details PF01699: Na_Ca_ex" amino acids 4 to 157 (154 residues), 55.9 bits, see alignment E=2.6e-19 amino acids 191 to 327 (137 residues), 50.6 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: K07301, inner membrane protein (inferred from 69% identity to rpf:Rpic12D_2541)

Predicted SEED Role

"Ca2+/Na+ antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1XPX6 at UniProt or InterPro

Protein Sequence (333 amino acids)

>ABZR86_RS05635 sodium:calcium antiporter (Dyella japonica UNC79MFTsu3.2)
MLTAFLFLLSAGAIYVACEYFVNGVEWFGRKLSLGATATGTVLAAFGTALPESAVTFVAV
VLGRTPEQKDIGVGAALGGPLVLATIAYAVVGLALWSNRRRLRRADNLVRVEHGRLARDQ
AWFLGIFVVKCGLGLIAFTWKPWLGVLFLAAYGLYVWRELQDDDTAPEEEELEPLKFQPK
ALDPALSRVLLQTTLALLVIAIASHTFVKQIEAIGLALQLSPHLVALVLSPVATELPETV
NALIWVRQGKERLALANISGAMMIQATIPSALAIFATPWLFDAPLMVAGALTGVAVIALW
WLFRRGRVDARWIVPVGALYGVFALYVAWHFAA