Protein Info for ABZR86_RS05545 in Dyella japonica UNC79MFTsu3.2

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 54 to 73 (20 residues), see Phobius details amino acids 80 to 97 (18 residues), see Phobius details amino acids 109 to 145 (37 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 285 to 302 (18 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details PF00953: Glycos_transf_4" amino acids 83 to 224 (142 residues), 93.1 bits, see alignment E=9.3e-31

Best Hits

Predicted SEED Role

"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1XN14 at UniProt or InterPro

Protein Sequence (344 amino acids)

>ABZR86_RS05545 glycosyltransferase family 4 protein (Dyella japonica UNC79MFTsu3.2)
MMMPPVLASAMVLAALVLALAIVLAAIAYARSRGMLDQPGQRRSHSIPTPRGGGIGVVIA
VLATSPWALLLFAPAWPWQLAVAFALATVLVAAIGWWDDHHSLPVLPRLGVQLGACLLFG
STLAFEGTSWLWLPLLVLGGAWSINLHNFMDGIDGLLAQQGLFVAVGLAVLAGGAGQVAL
AVSAACLAAAALGFWCYNRPRAAIFMGDVGSGTLGFLLFAFTVLLWRVDPGLLWPAAILS
SSFVTDATLTLLSRFLKGRRWYAPHREHLYQWLVRSGMSHAGGDTCYLAWNLLIAAPLAW
LSWFCPGWGWTICAVAYLIAGAAWMLARRYCLWRIQHKARHVRT