Protein Info for ABZR86_RS05510 in Dyella japonica UNC79MFTsu3.2

Annotation: subclass B3 metallo-beta-lactamase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00753: Lactamase_B" amino acids 52 to 242 (191 residues), 72.8 bits, see alignment E=3.7e-24 PF12706: Lactamase_B_2" amino acids 78 to 175 (98 residues), 31.9 bits, see alignment E=1.1e-11

Best Hits

Swiss-Prot: 38% identical to BLA1_STEMA: Metallo-beta-lactamase L1 type 3 from Stenotrophomonas maltophilia

KEGG orthology group: None (inferred from 48% identity to gau:GAU_3231)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1XP76 at UniProt or InterPro

Protein Sequence (293 amino acids)

>ABZR86_RS05510 subclass B3 metallo-beta-lactamase (Dyella japonica UNC79MFTsu3.2)
MKHPLHLFFAGAAALACASIHAAAADDRGWTRPEQPFRIYGDTWYVGTHGLSAILITSPQ
GHVLIDGTMPENARLVEQNIRSLGFRIGDVKAILNSHAHFDHAGAIAALAAASGAPVYAS
RYGAEELMAGGDYAEDPQNGEAPHFPKVAKVSVVADGGTVKVGDIVVTAHYTPGHTPGAT
TWTWRSCEKDRCLDVVYADSITAFTNGVYRYSDPAHPERVSGFRKTFDIVAALPCDVLIT
THPDMSDFLDRAAAHRAGKQPDPMIDRQACKALAQSSVVKFEAKLKEERAAKP