Protein Info for ABZR86_RS05500 in Dyella japonica UNC79MFTsu3.2

Annotation: trimeric intracellular cation channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 177 to 194 (18 residues), see Phobius details PF03458: Gly_transporter" amino acids 10 to 82 (73 residues), 74 bits, see alignment E=3.6e-25 amino acids 96 to 167 (72 residues), 78.8 bits, see alignment E=1.1e-26

Best Hits

KEGG orthology group: None (inferred from 67% identity to nmu:Nmul_A0854)

Predicted SEED Role

"FIG01211391: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1XM21 at UniProt or InterPro

Protein Sequence (212 amino acids)

>ABZR86_RS05500 trimeric intracellular cation channel family protein (Dyella japonica UNC79MFTsu3.2)
MAMTHFLLLVLDLLGTFVFALSGALTGVRRQLDLFGVLVLSFAAGNAGGITRDLLIGATP
PAAIADWRYLAVSMLAGIVTFYRYALIERLKNPVQLSDAAGLALFAVAGAQKALAHGLNP
AMAALLGMLTGVGGGILRDVLVTQIPTVLRADLYAVAALAGAAIVVAGDLLQVPPAVSTL
AGAAVCFGLRFMAIRYGWHLPRAATGGQEPPA