Protein Info for ABZR86_RS05455 in Dyella japonica UNC79MFTsu3.2

Annotation: 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00048: 23S rRNA (adenine(2503)-C(2))-methyltransferase
  • amino acids 10 to 362 (353 residues), 460 bits, E=2.4e-142
• PF21016: RlmN_N
  • amino acids 13 to 72 (60 residues), 96.6 bits, E=5.7e-32
• PF04055: Radical_SAM
  • amino acids 116 to 287 (172 residues), 68.5 bits, E=8.1e-23

Best Hits

Swiss-Prot: 70% identical to RLMN_XANAC: Dual-specificity RNA methyltransferase RlmN (rlmN) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K06941, ribosomal RNA large subunit methyltransferase N [EC: 2.1.1.-] (inferred from 70% identity to xac:XAC2016)

MetaCyc: 57% identical to 23S rRNA m2A2503 methyltransferase/tRNA m2A37 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11586 [EC: 2.1.1.192]; 2.1.1.- [EC: 2.1.1.192]

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.192

Sequence Analysis Tools

See A0A1I1XQQ0 at UniProt or InterPro

Protein Sequence (378 amino acids)

>ABZR86_RS05455 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN (Dyella japonica UNC79MFTsu3.2)
MNQAVSIPSAEKVNLLDFDRQGLRDFFARLGEKPYRAEQVMKWIYHRLEDNFENMTDVGK
ALRTKLEASCYIGPPKTMFDKGAADGTHKWLLGMDGGNAVEAVYIPEPTRGTLCVSSQVG
CGLNCQFCSTATQGFNRNLATSEIIGQMWVAAKYLGNVTHQNRRITNVVMMGMGEPLLNF
DNVVKAMSLMRDDLGFGLASKRVTLSTAGMVPMIDKLSEAIDVSLAVSLHAANDELRTEL
VPLNKRYPIEELLGACKRWLERKPRTSITFEYTLMKGVNDQPEHARQLIKLMRRLPNCKV
NLIPFNPFPGTRFERSDADTIRAFQTQLLNANILTMLRRTRGDDIDAACGQLKGQVLDRT
RRQAEFRKRLDEGASHAA