Protein Info for ABZR86_RS05450 in Dyella japonica UNC79MFTsu3.2

Annotation: type IV pilus biogenesis/stability protein PilW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR02521: type IV pilus biogenesis/stability protein PilW" amino acids 10 to 246 (237 residues), 208 bits, see alignment E=7.6e-66 PF07719: TPR_2" amino acids 42 to 74 (33 residues), 26.3 bits, see alignment 3.4e-09 PF13181: TPR_8" amino acids 42 to 74 (33 residues), 15.2 bits, see alignment 1.3e-05 amino acids 86 to 108 (23 residues), 13.1 bits, see alignment (E = 6.2e-05) amino acids 158 to 180 (23 residues), 15.3 bits, see alignment (E = 1.2e-05) PF13432: TPR_16" amino acids 90 to 139 (50 residues), 19.7 bits, see alignment 6.4e-07 amino acids 161 to 208 (48 residues), 26.2 bits, see alignment 6.3e-09 PF13374: TPR_10" amino acids 114 to 137 (24 residues), 18.3 bits, see alignment (E = 1.2e-06) PF14559: TPR_19" amino acids 161 to 216 (56 residues), 32 bits, see alignment E=8.4e-11 PF13174: TPR_6" amino acids 218 to 248 (31 residues), 15.6 bits, see alignment 1.3e-05

Best Hits

KEGG orthology group: K02656, type IV pilus assembly protein PilF (inferred from 35% identity to nhl:Nhal_1093)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1XR65 at UniProt or InterPro

Protein Sequence (260 amino acids)

>ABZR86_RS05450 type IV pilus biogenesis/stability protein PilW (Dyella japonica UNC79MFTsu3.2)
MRLDRILLAACLAAALTACTTTGTDPGPNPRVAKSDNAQEGARVHTELAQSYMQNGDLQG
ALTKLNKALSFDPNFVPAHTVMAVLDERIGNQAEAEKHYRKAVALAPDKGDTNNNLGAFL
CKTGRGTEAAQYFQKAVTDPFYQTPALAWTNAGRCVESGGGDVAAAEEDYRKAIALDPQN
AEALLRISSLLFQQNDAFRARAFLQRYDALEQPSPAGLKLGHDIELRLGNKDAARNYSRR
LQSQFPDSEQARAIDSTASQ