Protein Info for ABZR86_RS05430 in Dyella japonica UNC79MFTsu3.2

Annotation: ribosome biogenesis GTPase Der

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 TIGR03594: ribosome-associated GTPase EngA" amino acids 3 to 433 (431 residues), 550.4 bits, see alignment E=5e-169 TIGR00231: small GTP-binding protein domain" amino acids 4 to 156 (153 residues), 68.3 bits, see alignment E=1e-22 amino acids 178 to 321 (144 residues), 85 bits, see alignment E=7.4e-28 PF01926: MMR_HSR1" amino acids 5 to 119 (115 residues), 96.1 bits, see alignment E=8.8e-31 amino acids 179 to 297 (119 residues), 95.4 bits, see alignment E=1.4e-30 PF02421: FeoB_N" amino acids 5 to 154 (150 residues), 54.1 bits, see alignment E=8e-18 amino acids 179 to 343 (165 residues), 50.6 bits, see alignment E=9.5e-17 PF00009: GTP_EFTU" amino acids 178 to 345 (168 residues), 42.1 bits, see alignment E=4.4e-14 PF00350: Dynamin_N" amino acids 180 to 223 (44 residues), 28.5 bits, see alignment 8.6e-10 PF14714: KH_dom-like" amino acids 354 to 433 (80 residues), 85.5 bits, see alignment E=1.5e-27

Best Hits

Swiss-Prot: 58% identical to DER_STRM5: GTPase Der (der) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K03977, GTP-binding protein (inferred from 61% identity to xal:XALc_1586)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1XKF6 at UniProt or InterPro

Protein Sequence (466 amino acids)

>ABZR86_RS05430 ribosome biogenesis GTPase Der (Dyella japonica UNC79MFTsu3.2)
MLPVVALVGRPNVGKSTLFNAMTRSRDALVADMPGVTRDRHYGVCRTGERPFVVVDTGGL
SGVEEGLDALTAQQVRLAIEEAQVLVFVLDARDGVLPQDRAILDDLRRSGKPIIAAVNKT
DGLDLQNALAEFATFGLSSTLPLSAAHNRGTDDLVRHVLPLLAEDAHEELAPEDAGAIRV
AIVGRPNAGKSTLINRLLGEERLIVSSVAGTTRDPIRVPLERDGRRYVLIDTAGVRRKAR
VEEAVEKFSVIKTLQSIAAAQVVVVMIDARENLADQDLHLIGHAVDEGRALVIAVNKWDG
MDQYQREQCERALERRLQFVDWAKNVFISALHGSGLRELMRAIVRAHDAANREIGSSELT
RTLERAYEGYQPPLVRGHAPKLRFAHPGGSNPPTIVIHGSRTKHIAPAYRRYLENFFRKR
FKLEGTPVRIEFRDGENPYAGKKNVLTEGQQRKRQRMIREMKKRKR