Protein Info for ABZR86_RS05405 in Dyella japonica UNC79MFTsu3.2

Annotation: glutamine-hydrolyzing GMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 9 to 200 (192 residues), 246.6 bits, E=1.2e-77
• PF00117: GATase
  • amino acids 10 to 196 (187 residues), 148.1 bits, E=9e-47
• PF07722: Peptidase_C26
  • amino acids 73 to 179 (107 residues), 33 bits, E=1.9e-11
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 208 to 526 (319 residues), 488.6 bits, E=7.6e-151
• PF02540: NAD_synthase
  • amino acids 212 to 301 (90 residues), 30.6 bits, E=6.7e-11
• PF00733: Asn_synthase
  • amino acids 221 to 282 (62 residues), 21.9 bits, E=4.5e-08
• PF03054: tRNA_Me_trans
  • amino acids 225 to 290 (66 residues), 20.8 bits, E=9.2e-08
• PF00958: GMP_synt_C
  • amino acids 434 to 525 (92 residues), 141.7 bits, E=2.1e-45

Best Hits

Swiss-Prot: 86% identical to GUAA_XANAC: GMP synthase [glutamine-hydrolyzing] (guaA) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 86% identity to xac:XAC2287)

MetaCyc: 68% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

See A0A1I1XKB0 at UniProt or InterPro

Protein Sequence (526 amino acids)

>ABZR86_RS05405 glutamine-hydrolyzing GMP synthase (Dyella japonica UNC79MFTsu3.2)
MTDIHSDKILILDFGAQYTQLIARRVREIGVYCEIWAWDHDPAEIAAFGAKGIILSGGPE
STTLPGAPKAPQEVFDAGLPILGICYGMQTLAAQLGGATEAADAREFGHAEVDIAASSRL
FAGLSDHADAHRLDVWMSHGDHVAQAPPGFVVTGTTERIPVAVMEDEARRWYGVQFHPEV
THTRQGTALLKRFVTEICGCRTLWTAAHIIEDQIARVRAQVGDDHVLLGLSGGVDSSVVA
ALLHRAIGDRLTCVFVDTGLLRWKEGDQVMATMAEHMGVKVIRVDAAERYFKALEGEADP
EAKRKIIGRLFVEIFDEESAKVTAAGSGHVKWLAQGTIYPDVIESAGSKTGKAHVIKSHH
NVGGLPEHMKLKLVEPLRELFKDEVRRIGVELGLPREMVYRHPFPGPGLGVRILGEVKPE
YAELLARADAIFIEELRRWDLYDKTSQAFAVFLPVKSVGVVGDARAYEWVIALRAVETID
FMTAHWAHLPYDFLGKVSNRIINELRGVSRVVYDISGKPPATIEWE