Protein Info for ABZR86_RS05330 in Dyella japonica UNC79MFTsu3.2

Annotation: AarF/UbiB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 484 to 504 (21 residues), see Phobius details amino acids 510 to 531 (22 residues), see Phobius details PF03109: ABC1" amino acids 80 to 322 (243 residues), 216 bits, see alignment E=4.6e-68 PF01636: APH" amino acids 248 to 296 (49 residues), 23.4 bits, see alignment 4.8e-09

Best Hits

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1XIV0 at UniProt or InterPro

Protein Sequence (547 amino acids)

>ABZR86_RS05330 AarF/UbiB family protein (Dyella japonica UNC79MFTsu3.2)
MTYLSRYSRIAVFVMRYRRAGVLRGVPGHRRGGELADERLPQRLVADLERLGPAFIKLGQ
ALSCRPDLVRAPFLAALTRIQDRVEPIGVEEVRAVIARELGAPPEQLFRFFDPVPLAAGS
LAQVHAVVLPDGMEAVVKVQRPGIAQRIRSDLDALERLALTAQRHTEVGRRYGFVPWIAE
LRRSLLNELDFMAEANHLETFRRHLEGYRGLYIPTPFFEFTTSRVLAMARVRGHKLGAPP
AGEAQPPRAELAGELLSAYVDQVFVHGLIHADPHPGNLVLMEDGRLGLLDFGMVTSLSPA
MRNDLLRLMLAAADGDGDGVAEIGERLCVVLPEMDRAAYRRAVCHVVLRYASASDQSRLE
EGRLLLSLTRIGADNGLRPPAELSLLGRALLNLEPALARLADNLPTREMMRTRLLEVVAA
QLLRPVSQARGGALLLEAQRFSINAPGQLGRFAEILADNRLRVRIDGLEESHLIENLQKI
ANRIAAGVITAALLIAGALIARLAPAGSGYGYLAGAMFALAGIVGFGLVVNALRRDRSPP
DDTDAGR