Protein Info for ABZR86_RS05315 in Dyella japonica UNC79MFTsu3.2

Annotation: alpha/beta fold hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 320 to 340 (21 residues), see Phobius details PF00156: Pribosyltran" amino acids 14 to 184 (171 residues), 68.7 bits, see alignment E=9.4e-23 PF01738: DLH" amino acids 244 to 415 (172 residues), 27.9 bits, see alignment E=4.3e-10 PF20408: Abhydrolase_11" amino acids 245 to 409 (165 residues), 33.5 bits, see alignment E=9e-12 PF00561: Abhydrolase_1" amino acids 246 to 352 (107 residues), 27.8 bits, see alignment E=4.9e-10

Best Hits

Swiss-Prot: 49% identical to Y0571_MYCTO: Putative phosphoribosyl transferase MT0597 (MT0597) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 48% identity to apn:Asphe3_00740)

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1XIF5 at UniProt or InterPro

Protein Sequence (429 amino acids)

>ABZR86_RS05315 alpha/beta fold hydrolase (Dyella japonica UNC79MFTsu3.2)
MMLPRQGYFDDREHAAERLAEALLAYRGRHPLVLAIPRGGVPIGRVLADRLDGDLDVVLV
RKLGAPGQEEFAVGAVSEDGQLLVAEHAARAGADDAYLRGELARQLEVIARRRELYSAHR
EALDPTGRTVIVVDDGLATGATMRAALAAVRAAGPQSLVCAVPVASPRSLAEVRPLCDDV
VCPAAPREFQAVSQYYRAFSAVTDDEVVRLLARQPAPAGAMQAVRIPADGVRLEGDLHVP
DAASGLVVFAHGSGSSRFSPRNRQVAEALAQHGLATLLFDLLGAEEDVALAARFDIERLA
GRLEAAVEWAVRLPSLARLPLGLFGASTGAAAALAVAARLPRAVKAVVSRGGRPDLAGHA
VLGDVQAPTLLIVGSADTDVITLNKSALASMTHTVELVLVPGATHLFDEPGALEHVAALA
GAWFRQWLQ