Protein Info for ABZR86_RS04925 in Dyella japonica UNC79MFTsu3.2

Annotation: DUF2169 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 862 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details PF09937: DUF2169" amino acids 20 to 305 (286 residues), 246.7 bits, see alignment E=6.9e-77 PF00805: Pentapeptide" amino acids 552 to 579 (28 residues), 29.7 bits, see alignment (E = 7.7e-11) amino acids 582 to 619 (38 residues), 28.1 bits, see alignment (E = 2.4e-10) amino acids 628 to 655 (28 residues), 16.3 bits, see alignment (E = 1.2e-06) amino acids 746 to 782 (37 residues), 30 bits, see alignment (E = 6.1e-11) amino acids 778 to 815 (38 residues), 17.8 bits, see alignment (E = 3.9e-07) amino acids 822 to 855 (34 residues), 27.2 bits, see alignment (E = 4.5e-10) PF13599: Pentapeptide_4" amino acids 774 to 845 (72 residues), 31.8 bits, see alignment E=2.9e-11

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1XER5 at UniProt or InterPro

Protein Sequence (862 amino acids)

>ABZR86_RS04925 DUF2169 domain-containing protein (Dyella japonica UNC79MFTsu3.2)
MKIVKPMTLSLMHRPYRWQGRDRLLVATLGFFALGGRPEALLRDNLQWRKVMSALPPGRP
LDELMPKTRGEVLLAGNAYAANGLAVTEQTVRLSVAGVDKRLRVVGDRQWMYGMLPWLQV
TEPLPFTQMPLTWNRAYGGAGHPANPEGRGYARNPLAAFFGRNHGDMPNLEHPQRPVRGP
RRRYAPAGFGQLDVGWTPRRQWIGSYGRRWRSDTYPGLADDTHPEFFNAAPLDQRIEGFF
AGGEPYRLEGMHPRLPVIEGHLPEFRPRAFAHRAGQPADAAQEIALSFDTVWFFPDAELG
VTIHRGEIEVEDSLALDVEALMVAYEYAADAPRPLSHYGEVLALRLNRDTAARHVFNEAQ
LTPEPDAVLRAARHAEVQDEQQRRQAARAAREAGLAAEFEASAGMPAPPPPPAPLAVDLP
VPSAAEIRRGDFDLGATLDAVDRIGREAREQAQAQREEAAAQLAPLPQAPPAAATSTEEA
LARAAGQGGAIGALGEFGALAGVPPVAVEQIQELQRKGRLASPQPSVPGLPLQPEVAAAI
GQWLLLRVREGGSLRGCDLAGADLRNAMLSGADLRGALLEASDLRGAQLDGADLSEVALT
GATMDAANFAAACFDGANLARTRARGAVFRGASFAGTQAGDADWSRADLAGARFERWIAP
NIVLEDANLEHATLADCVLLHAKADGSRWAHAAWQRTVALGSSLAGSDWREAALSRSVLM
ECRLTDSHWAGADLARVQGGGGADWSRADLQRVRADHSSWRGANLTDANLAEGQFRECDF
SGARLTHAVLERTLFYRSLFMGGELTGCHAGAADFYQAMCRRADFREADLREANFVQAEC
AEARFDHARLEGVRLEPGRSLP