Protein Info for ABZR86_RS04920 in Dyella japonica UNC79MFTsu3.2

Annotation: pentapeptide repeat-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 PF13576: Pentapeptide_3" amino acids 42 to 85 (44 residues), 30.1 bits, see alignment 7e-11 PF00805: Pentapeptide" amino acids 48 to 84 (37 residues), 36 bits, see alignment 6e-13 amino acids 80 to 107 (28 residues), 20.3 bits, see alignment (E = 4.9e-08) amino acids 180 to 214 (35 residues), 25.7 bits, see alignment 1.1e-09 amino acids 205 to 242 (38 residues), 37.3 bits, see alignment 2.4e-13 PF13599: Pentapeptide_4" amino acids 56 to 132 (77 residues), 57.6 bits, see alignment E=1.8e-19 amino acids 250 to 322 (73 residues), 27.9 bits, see alignment E=3.4e-10

Best Hits

KEGG orthology group: None (inferred from 37% identity to bgl:bglu_2g07410)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1XD77 at UniProt or InterPro

Protein Sequence (360 amino acids)

>ABZR86_RS04920 pentapeptide repeat-containing protein (Dyella japonica UNC79MFTsu3.2)
MSAATVLGWDDIARLQVLGRPVHGIDLGVLDGSGRALASLLFNQAIWRGARLHGAHLQHV
NFIECDLREADFGGATLEACSFTRCKLDGARWDGANLQQCAFTQVDLPASTWSKAEIALS
AFTQSKLRGASFAHAVLHRSVIAQCELAGLGLAHATLAQAVLPGVDFRDFDVRGLVAQSA
VLQGARFDGMDLRGQVLQRCLLEGANFSGARLDGADLREANLRKAVLAGASLRAAKLDNA
LLLESSWSEVDAAGLSCEGALFQSAELRKVSFAGARGPGSVWDHARLAEVDFGQAMFAYA
RFDHASGERLRFHRARLDHASFHHTRFVDADFSAAHTRRLRGTSQPRLAAEARALALEMS