Protein Info for ABZR86_RS04740 in Dyella japonica UNC79MFTsu3.2

Annotation: DegT/DnrJ/EryC1/StrS family aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF01041: DegT_DnrJ_EryC1" amino acids 18 to 362 (345 residues), 378.9 bits, see alignment E=1.4e-117

Best Hits

Swiss-Prot: 54% identical to FDTB_ANETH: dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose transaminase (fdtB) from Aneurinibacillus thermoaerophilus

KEGG orthology group: None (inferred from 73% identity to xop:PXO_00203)

MetaCyc: 54% identical to dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose transaminase (Aneurinibacillus thermoaerophilus L420-91)
RXN-12811 [EC: 2.6.1.90]

Predicted SEED Role

"Aminotransferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.90

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1X9D4 at UniProt or InterPro

Protein Sequence (370 amino acids)

>ABZR86_RS04740 DegT/DnrJ/EryC1/StrS family aminotransferase (Dyella japonica UNC79MFTsu3.2)
MSVPFFDLQAVNARYAEALKAAAARVIDSGWYILGGELEAFEREFADYCGVRHALGVGNG
LDALALILRAYIGLGVLREGDEVIVPANTFIATFLAVSQSGLVPVPVEPDPVTFNLDPAR
VELAIGPRTRAVIAVHLYGQLAEMPVLAALARRRGLLLIEDAAQAHGAALDGCKAGAFGD
AAAFSFFPTKNLGALGDGGAVTTSDDALARRVAALRNYGSETKYHHLFQGVNSRLDELQA
ALLRVKLAHLDEEILLRRRIARRYREGIVHPAIAPPQVTREDGHVWHLFVLRCRRRDALQ
RHLQAWGIHTQVHYPVPAHRQPAYSEWHRLHLPVTERLHAEVLSLPLNPALDEAAVERVI
AACRAFKGNA