Protein Info for ABZR86_RS04545 in Dyella japonica UNC79MFTsu3.2

Annotation: selenide, water dikinase SelD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 TIGR00476: selenide, water dikinase" amino acids 5 to 314 (310 residues), 422.6 bits, see alignment E=4.6e-131 PF00586: AIRS" amino acids 48 to 154 (107 residues), 94.2 bits, see alignment E=7e-31 PF02769: AIRS_C" amino acids 167 to 339 (173 residues), 77.4 bits, see alignment E=1.4e-25

Best Hits

Swiss-Prot: 76% identical to SELD_METSB: Selenide, water dikinase (selD) from Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)

KEGG orthology group: K01008, selenide, water dikinase [EC: 2.7.9.3] (inferred from 76% identity to msl:Msil_3330)

Predicted SEED Role

"Selenide,water dikinase (EC 2.7.9.3)" in subsystem Selenocysteine metabolism (EC 2.7.9.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.9.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1X7F5 at UniProt or InterPro

Protein Sequence (346 amino acids)

>ABZR86_RS04545 selenide, water dikinase SelD (Dyella japonica UNC79MFTsu3.2)
MASERLTDLAHGGGCGCKLAPAVLQELLAGKAAAMPFAQLLVGTESSDDAAVWQVDERTC
VIATTDFFMPVVDDPYDFGRIAAANALSDVYAMGGKPIMALAILGMPLGKLEVDTVRAIL
AGGEAVCAQAGIPVAGGHSIDAAEPIYGLAAIGLCTPAQLRRNSGARPGDALILTKGLGV
GIYSAAFKKQVLPADAYDEMLASTTLLNRIGHELAQDDDVHAITDVTGFGLLGHGLEMAR
GSGVRIRIEQARLPFFAKAEALAEAGYVTGASKRNWSSYGDGVALPADLPEWRRALLTDP
QTSGGLLVACKAERAEALRATIEAAGYPRASIIGAVAAGVPGIEVI