Protein Info for ABZR86_RS04535 in Dyella japonica UNC79MFTsu3.2

Annotation: selenocysteine-specific translation elongation factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 662 TIGR00475: selenocysteine-specific translation elongation factor" amino acids 1 to 630 (630 residues), 393.4 bits, see alignment E=9.8e-122 PF00009: GTP_EFTU" amino acids 2 to 162 (161 residues), 106.1 bits, see alignment E=5.1e-34 PF01926: MMR_HSR1" amino acids 3 to 99 (97 residues), 25.5 bits, see alignment E=3.7e-09 PF03144: GTP_EFTU_D2" amino acids 191 to 259 (69 residues), 34.2 bits, see alignment E=8.5e-12 PF09106: SelB-wing_2" amino acids 445 to 500 (56 residues), 48.2 bits, see alignment 2.9e-16 PF21214: bact_SelB_WH_2nd" amino acids 509 to 568 (60 residues), 35.6 bits, see alignment 2.2e-12 PF09107: SelB-wing_3" amino acids 591 to 630 (40 residues), 52.1 bits, see alignment 1.1e-17

Best Hits

KEGG orthology group: K03833, selenocysteine-specific elongation factor (inferred from 65% identity to msl:Msil_3332)

Predicted SEED Role

"Selenocysteine-specific translation elongation factor" in subsystem Selenocysteine metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (662 amino acids)

>ABZR86_RS04535 selenocysteine-specific translation elongation factor (Dyella japonica UNC79MFTsu3.2)
MIVGTAGHIDHGKTSLIKALTGVDGDRLKEEKARGITIDLGFAYLPLADGTTLGFVDVPG
HERFVHTMVAGASGIDIALLVVAADDGVMPQTLEHLAILDLLQIRRGLIALTKVDLAPPG
RLAEVGAQIRAATAGSVLEAADVFPISSTTGLGIDALRERLAAEAHTLGERAADGRFRLA
VDRVFTLPGIGLTVTGTVLSGAVRVKDQMMLSPSGLSARVRSLHAQNRAVELGRAGDRCA
LNLAGDGVAKDAIRRGDMVVDPFLHAPVDRIDARLLLLPGEPKPIGQWFPARLHHGASEV
GARVVLIEGEQLAPGHAADVQLVLNRPIAAAALDRFVLRDVSAQRTIGGGQFLDLRAPPR
QRRTAERQAQRAARLLADPLEAFAALLDTPPFAWDLTAFARDRALSQSRIDSIVKSLAPV
LFATGEERIAVGQVHWQRFVARLVEHLETFHAANPDLQGIGRERLRLALQPRLPAPAFAL
ALQHPDLAARIVRDGAFVRLPGHTMRLGPEREALWQALAPLLGGEARFRPPRVRDLAWML
ARQEAEIRQLLKFAARLGRVDEVAHDHFFLRATMHEMTLIAADLAAGAPDGCFTAAQFRD
RVDNGRKVAIQILEFFDRQGVTLNRGTLRRVQPRYLDLFAPAAGATHGRESSPVGRPDFK
SG