Protein Info for ABZR86_RS04525 in Dyella japonica UNC79MFTsu3.2

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 transmembrane" amino acids 10 to 29 (20 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 108 to 133 (26 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 262 to 280 (19 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 325 to 348 (24 residues), see Phobius details PF03773: ArsP_1" amino acids 74 to 344 (271 residues), 85.5 bits, see alignment E=1.9e-28

Best Hits

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1X4V3 at UniProt or InterPro

Protein Sequence (350 amino acids)

>ABZR86_RS04525 permease (Dyella japonica UNC79MFTsu3.2)
MAIALPAGRMLRLGVFVSLAIAGLFYVKWHPYYDRAFVAASGHSIGHSILMGDAAAAPAP
SWQAAFAYALAYGKAIWQAMVLGLLLGSGIQALLPADWVRRMLGGRGFGSVLAGGLLALP
GMMCTCCAAPVVAGMRGQRAAPGAAIAFWLGNTVLNPATLVFTGFVLGWHWTLLRLCLGV
PMVFGLGYLASRMTGSGSVATVDMPDTEPEPYSLAEAVRRWAKIFARMAVRLLPEYLVIV
LLLGAFRAWMFPAIGPAIGDQWFWIVAMALAGMLFVIPTAGEVPIVQAMLALGMGSGPAA
ALLLTLPPVSLPSLAMLARSFPWRVLLAVALAVVGFGVLGGAVAAWLHLA