Protein Info for ABZR86_RS04445 in Dyella japonica UNC79MFTsu3.2

Annotation: cytochrome-c oxidase, cbb3-type subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00781: cytochrome c oxidase, cbb3-type, subunit II
  • amino acids 16 to 192 (177 residues), 235.9 bits, E=2.4e-74
• PF02433: FixO
  • amino acids 17 to 192 (176 residues), 237.5 bits, E=6.1e-75

Best Hits

KEGG orthology group: K00405, cb-type cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 67% identity to psu:Psesu_0342)

MetaCyc: 64% identical to cbb3-2 cytochrome c oxidase subunit O (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoO (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• arsenite to oxygen electron transfer (1/2 steps found)
• aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
• arsenite to oxygen electron transfer (via azurin) (1/3 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

See A0A1I1X377 at UniProt or InterPro

Protein Sequence (228 amino acids)

>ABZR86_RS04445 cytochrome-c oxidase, cbb3-type subunit II (Dyella japonica UNC79MFTsu3.2)
MSAAPGTGFRRYRYFEFIETHAGLLGVLIAIAVSFGGLAEIIPLFFQAHVIKPSPGVEPR
DPLRLAGFDVYVREGCYGCHSQMIRTLRAETERYGHYSDAGESVYDHPHQWGSKRTGPDL
ARVGGKYSDDWQRRHLMNPRDVPGGKDSNMPGYPWLAARPLDAADVQARMKVLRQLGTPY
RDADIAAAPATLQGKTELDALVAYLQGLGTALPAAGVHDAATPAENAP