Protein Info for ABZR86_RS04320 in Dyella japonica UNC79MFTsu3.2

Annotation: CBS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00571: CBS
  • amino acids 3 to 56 (54 residues), 45.9 bits, E=5.8e-16
  • amino acids 90 to 144 (55 residues), 58.9 bits, E=5.1e-20
• PF04972: BON
  • amino acids 159 to 226 (68 residues), 42.2 bits, E=8.3e-15

Best Hits

KEGG orthology group: None (inferred from 43% identity to ret:RHE_PC00107)

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• inosine 5'-phosphate degradation (2/4 steps found)
• purine nucleotides degradation I (plants) (7/12 steps found)
• ureide biosynthesis (2/7 steps found)
• purine nucleotides degradation II (aerobic) (4/11 steps found)
• superpathway of purines degradation in plants (7/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

See A0A1I1X0S7 at UniProt or InterPro

Protein Sequence (238 amino acids)

>ABZR86_RS04320 CBS domain-containing protein (Dyella japonica UNC79MFTsu3.2)
MKVADAMTCQVRTVLATDSVSLAMQIMRGVRVSGLPVLDGDGHLVGMVTTGDLLRRAELG
TERHRPHWLEKILGPRRMAQEYMASHSRRIGDLMTAPVLTIDEGAPLIDAVDLLEKHHIK
RLPVTHKGRLIGIISRTDLMRILLERLPSADDAATRMWSDAQIQRHIAEEIGQQPWLAQA
AVQVSVHRGTVDICGTVAHDAMRHALRVLLENTPGVSQVMDRLLVQRRRDRRHSLAHR