Protein Info for ABZR86_RS04095 in Dyella japonica UNC79MFTsu3.2

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 31 to 288 (258 residues), 162.5 bits, see alignment E=2.2e-51 PF00532: Peripla_BP_1" amino acids 49 to 287 (239 residues), 47.6 bits, see alignment E=2.5e-16 PF13377: Peripla_BP_3" amino acids 171 to 256 (86 residues), 27.6 bits, see alignment E=4.6e-10

Best Hits

Swiss-Prot: 56% identical to YTFQ_ECOLI: ABC transporter periplasmic-binding protein YtfQ (ytfQ) from Escherichia coli (strain K12)

KEGG orthology group: K02058, simple sugar transport system substrate-binding protein (inferred from 80% identity to psu:Psesu_0884)

MetaCyc: 56% identical to galactofuranose ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-491 [EC: 7.5.2.9]; 7.5.2.9 [EC: 7.5.2.9]

Predicted SEED Role

"Putative sugar ABC transport system, periplasmic binding protein YtfQ precursor"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1X0C1 at UniProt or InterPro

Protein Sequence (319 amino acids)

>ABZR86_RS04095 ABC transporter substrate-binding protein (Dyella japonica UNC79MFTsu3.2)
MKNACVLLAMLAIALAGCSRDAGKQVGQVTVGFSQVGAESEWRTANTASVKSALVAPGFD
LKFSDAQQKQENQIKALRSFIAQRVDVIAFSPVVESGWEPVLREAKAAGIPVVLTDRAVK
VSDASLYASLIGSDFIEEGRKAGRWLLQDSTGKPGPIRVVELQGTVGSAPAIDRMKGFHE
VIDTDPRFKLVRSQSGDFTRAKGKEVMEAFLKAEGGHIDVLFAHNDDMAIGAIQAIEEAG
LTPGKDIRIVSIDGVRGAFEAMKAGKLNATIECNPLFGAQLAQLIRDVHAGKPVPKRIVV
EEGVFTQDQAAAALPGRKY