Protein Info for ABZR86_RS04030 in Dyella japonica UNC79MFTsu3.2

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 18 to 202 (185 residues), 156.6 bits, E=8.4e-50
• PF08659: KR
  • amino acids 21 to 174 (154 residues), 43 bits, E=7.5e-15
• PF13561: adh_short_C2
  • amino acids 27 to 258 (232 residues), 197 bits, E=5.8e-62

Best Hits

Swiss-Prot: 36% identical to Y182_METEA: Uncharacterized oxidoreductase MexAM1_META1p0182 (MexAM1_META1p0182) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)

KEGG orthology group: None (inferred from 62% identity to bgd:bgla_2g29390)

MetaCyc: 34% identical to NADP+-dependent aldehyde reductase (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• palmitate biosynthesis III (28/29 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (23/25 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
• biotin biosynthesis I (14/15 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• 8-amino-7-oxononanoate biosynthesis I (10/11 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (25/205 steps found)
• superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

See A0A1I1WUL4 at UniProt or InterPro

Protein Sequence (260 amino acids)

>ABZR86_RS04030 SDR family oxidoreductase (Dyella japonica UNC79MFTsu3.2)
MATLFSLSLESNMKLKNKVAFITGGTSGIGLETAKLFRAEGAQVVIVGSNAERLAEAGKE
LGGEVLLVSADLRKVEDIEHAVEQARAAFGRIDIVFANAGASTVAPLEAITPAYVEENVA
LNFAGVLFTIQKTAPLVPKGGSIIVTTSFLNTVGKPGLSVLAATKAAARSLVRTLGAELA
PRGIRVNAVSPGTIATPFYSKIGLTDAQLTEVAAALTEQVGLKRFGDPAEVAKAVLFLAS
NDSSYTTGVELVVDGGLTQF