Protein Info for ABZR86_RS03975 in Dyella japonica UNC79MFTsu3.2

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF01135: PCMT" amino acids 18 to 93 (76 residues), 34.4 bits, see alignment E=1e-11 PF13489: Methyltransf_23" amino acids 22 to 148 (127 residues), 45.6 bits, see alignment E=3.2e-15 PF02353: CMAS" amino acids 22 to 79 (58 residues), 31.2 bits, see alignment E=7.3e-11 PF05175: MTS" amino acids 27 to 101 (75 residues), 24.2 bits, see alignment E=1.2e-08 PF13847: Methyltransf_31" amino acids 28 to 131 (104 residues), 72.7 bits, see alignment E=1.4e-23 PF01209: Ubie_methyltran" amino acids 28 to 132 (105 residues), 47.9 bits, see alignment E=5.8e-16 PF02390: Methyltransf_4" amino acids 32 to 89 (58 residues), 31 bits, see alignment E=8.5e-11 PF13649: Methyltransf_25" amino acids 32 to 126 (95 residues), 76.2 bits, see alignment E=1.4e-24 PF08242: Methyltransf_12" amino acids 33 to 129 (97 residues), 53.5 bits, see alignment E=1.6e-17 PF08241: Methyltransf_11" amino acids 33 to 131 (99 residues), 72.9 bits, see alignment E=1.4e-23

Best Hits

KEGG orthology group: None (inferred from 63% identity to sme:SMa0169)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1WTN3 at UniProt or InterPro

Protein Sequence (254 amino acids)

>ABZR86_RS03975 class I SAM-dependent methyltransferase (Dyella japonica UNC79MFTsu3.2)
MSFHRADFYDAELRRHHGHFRAALDIAPGDRVLDIGCGAGQSTRDAARAASDGSVLGVDV
SEELLQVARERTAQDGLRNIAFELGDAQTHAFPGAHFDLCISRFGTMFFADPVAAFANIG
RSLRPGARLVLMLWQARERNEWATAIQDALAPGSAPAAAAAFSLADPAVATDLLKATGFA
SITFTDVHEPVFYGPTVDAAYEAVVGLFVGKDAPAGADTDKTLQRLHALVEAHLAQDGVW
FDSRAWIVTAHKAA