Protein Info for ABZR86_RS03955 in Dyella japonica UNC79MFTsu3.2

Annotation: DEAD/DEAH box helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 802 PF04851: ResIII" amino acids 73 to 209 (137 residues), 24 bits, see alignment E=8.1e-09 PF00270: DEAD" amino acids 75 to 244 (170 residues), 114.7 bits, see alignment E=9.7e-37 PF00271: Helicase_C" amino acids 303 to 406 (104 residues), 53 bits, see alignment E=9.8e-18 PF22982: WHD_HRQ1" amino acids 445 to 510 (66 residues), 34.9 bits, see alignment E=6.5e-12 PF09369: MZB" amino acids 727 to 774 (48 residues), 45 bits, see alignment 3.6e-15

Best Hits

KEGG orthology group: K06877, (no description) (inferred from 77% identity to smt:Smal_0080)

Predicted SEED Role

"ATP-dependent RNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1WXS8 at UniProt or InterPro

Protein Sequence (802 amino acids)

>ABZR86_RS03955 DEAD/DEAH box helicase (Dyella japonica UNC79MFTsu3.2)
MRAPLPAIIADEDDGRLLQLSGAELAGRLVQRYGERVTGHFVMEGRDGRYVPLPDDLPAP
VAAALRTRGVARLYEHQGQAWAATARGEHIVVATPTASGKSLCFTLPVLTSVMTAGKKAL
YLFPTKALAQDQVAELLELNAAGELGVRAFTFDGDTPGDARQAIRLHGDVVVSNPDMLHQ
AILPHHTKWAQFFENLRYVVIDEVHTYRGVFGSHVANVLRRLRRVCAFYGVTPQFILCSA
TIGNPAEHARALIEQPVTPILESGAPTGPKHVLLWNPPVVNADLGLRASARSQTNRIART
AIRAGLKTLVFAQSRLMVEVLTKYLKDVFDHDPRKRPRIRAYRGGYLPTERRQAERDMRA
GQVDGIVSTSALELGVDIGALDVTILNGYPGSVAATWQRFGRAGRRQQPSLGILVASSEP
LDQYLVRHPEYFQDASPEHARIAQDQPLILLDHIRCAAFELPFRAGDAFGGQLVEPWLEV
LAEEGVLHREGERFEWIADSYPANAVSLRSVAEGNFVVVDRTGGRQAIIAEVDYSAAPLT
LYEGAIHMVQSVPYQVERLDWTGRKAYVTRTEADYYTDAIDYTKLKVLDGFDVSVSGRGE
CHHGEVHVVRRVAGYKKIRYYTHENIGYGNVNLPDSELHTTAVWWALAQRTLDEAFERRQ
DALDGFLAAATALHTVATVAVMAEGRDLQKAVGSGDGAWFATPDSSGHARVRTGWGDEGV
DPHAPFIPTLYLYDAFPGGVGLSAPLFDRRAELVDRARQLIGQCDCRLGCPACVGPVLAS
DETAARSMKELGTAVLDLLADL